PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013587448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 517aa    MW: 58661 Da    PI: 6.2113
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013587448.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14.1e-103654021954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  XP_013587448.1 365 FEHflHPYPKEAEKMMLAKQTGLSKNQVANWFINARVR 402
                     664459******************************88 PP

2BELL112.13.1e-36221292172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqel++kk+kLl++++eVdkrY+qy++q+++++ssFe+vag gsakpYts+Al++iS +Fr+L+dai+eqi
  XP_013587448.1 221 ERQELRNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGFGSAKPYTSVALNKISCSFRSLRDAIKEQI 292
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-45156290IPR006563POX domain
PfamPF075265.3E-44162288IPR006563POX domain
PROSITE profilePS5007112.552343406IPR001356Homeobox domain
SMARTSM003891.1E-9346410IPR001356Homeobox domain
CDDcd000861.37E-11346407No hitNo description
SuperFamilySSF466893.04E-17347411IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-27349410IPR009057Homeodomain-like
PfamPF059204.3E-18363402IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MAVYYSSNAN CYQQEPIYLN HQQQQQQQAS SSSAAASFVG ENVRNEMAFI PPTTGLQTLN  60
GDATGNGAVS SSDLSFYDGQ GLSLSLGNQI SLPSFHHQQY HHLGFTPNPS ISAKETPPFD  120
VEEKSKEMML SLVGQSDPSS GYAGLYNNYR FNETSGGFMS GVLRSRYLKP AQNLLDEVVS  180
VKKELNQMRK KKKKGEDFNN GSKDTQGELS TDSNVKLSTI ERQELRNKKN KLLTMVDEVD  240
KRYNQYYHQM EALASSFEIV AGFGSAKPYT SVALNKISCS FRSLRDAIKE QIQIIREKLG  300
EKGGGELSLD EHQGGGERIP RLRYLDQRLR QQRAFHQQLG MVRPSWRPQR GLPENSVSVL  360
RAWLFEHFLH PYPKEAEKMM LAKQTGLSKN QVANWFINAR VRLWKPMIED IYKEEFGDES  420
ELQISKSSQE PNSTNQEDSS SQQQQEDNKN NLAYPSADTT NIDDEPQQQQ MNRSGDYETL  480
MNNYQGFGLE EEYRYVGGSN QEDSRFSNAH HLHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-16352409562Homeobox protein Meis2
3k2a_B6e-16352409562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895580.0AC189558.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH006P24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587449.10.0PREDICTED: BEL1-like homeodomain protein 10
RefseqXP_013587448.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A0D3CBK80.0A0A0D3CBK8_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10